PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_58F294736.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 126aa    MW: 14256.2 Da    PI: 10.6442
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_58F294736.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.53.9e-1559101547
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                            +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk
  Traes_3AL_58F294736.2  59 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK 101
                            69***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-1355113IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.70257102IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.06E-1259103No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-1559102No hitNo description
PfamPF001701.6E-1359102IPR004827Basic-leucine zipper domain
CDDcd147073.16E-2459104No hitNo description
PROSITE patternPS0003606277IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MPIQFVPQPL NVVGPGATLG SAYSDGQSTS PMISPISDSQ TPGRKRGVSG DVPNKFVERR  60
QKRMIKNRES AARSRARKQA YTNELENKVS RLEEENERLK KQKVFSFQYK FTEMPHFSVE  120
VGLPDK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3739191e-149AK373919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3047H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754827.14e-55PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014754826.14e-55PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES37e-32AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLW5CCY37e-89W5CCY3_WHEAT; Uncharacterized protein
STRINGMLOC_16096.19e-82(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-33ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]